PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA15G00321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 318aa    MW: 36855.1 Da    PI: 6.1658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA15G00321genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.4e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd+ l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
       AA15G00321 16 RGPWSPEEDLTLITFIQKHGHHNWRSLPKLAGLMRCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding50.93.5e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
       AA15G00321  69 RGSFSKEEEDTIIHLHQSLGNK-WSKIASYLP-GRTDNEIKNVWNTHL 114
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.981163IPR017930Myb domain
SuperFamilySSF466891.25E-3013110IPR009057Homeodomain-like
SMARTSM007171.8E-121565IPR001005SANT/Myb domain
PfamPF002491.7E-151663IPR001005SANT/Myb domain
CDDcd001677.09E-91863No hitNo description
PROSITE profilePS5129425.05964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2767118IPR009057Homeodomain-like
SMARTSM007171.5E-1468116IPR001005SANT/Myb domain
PfamPF002492.1E-1569114IPR001005SANT/Myb domain
CDDcd001671.00E-871114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MRKGRAPCCE KSRVKRGPWS PEEDLTLITF IQKHGHHNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPDVKRG SFSKEEEDTI IHLHQSLGNK WSKIASYLPG RTDNEIKNVW NTHLKKRLIL  120
LSSPHDDFLS SSSSSSSSLS SSSSASNSNI HDDRSSLKAN ERVDKRCDEV EASMEHLQEE  180
GNSEVNQGVS SYMEMRKGEV EEFNDMEEMQ LLLYHDDIHH HISSHPLDLL LDHHQYHIST  240
ELFNTNGKGK GKGRGEELKL KKGECGDEWS ETYMVDSYRL EETYPERNGE VLEWVNEEIP  300
LEFVSWRELF EWSPKGED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-27161184105MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-26161184105C-Myb DNA-Binding Domain
1mse_C1e-26161184105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392560.13e-82hypothetical protein EUTSA_v10012163mg
TrEMBLV4MEZ13e-82V4MEZ1_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__4638__AT1G56160.12e-79(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.13e-77myb domain protein 72